I have long had a theory that many on this planet never reach the maturity or consciousness level beyond a 15-16-year-old-boy--because they simply can't. Just look at what they do, worldwide, with their bandwidth. The bat/pig explosive diarrhea virus gambit proves it once and for all.
As an aside, Yesterday was another example of their childishness. On Thanksgiving, the elites in France (Macrons in center stage) were out in full fancy with two demon/hybrids at a parade. They can no longer hide that they are juvenile delinquents.
Jessica - any awareness of GOF on enteroviruses? Asking because reportedly the UK did a table-top and more "exercise" for 3 months this fall for a pandemic targeting kids (pigs also mentioned) - their pathogen choice was the enterovirus EV-D68:
"The real EV-D68 is a respiratory virus first isolated in California in 1962, which has gained global traction. As well as respiratory disease and meningitis, it can cause a polio-like paralysis in children known as acute flaccid paralysis."
Interesting read as this "exercise" also included lockdowns, handling social distancing protests and more.
You talk of ‘viruses’, nudge nudge, as if they’re a proven entity, when even a child can grasp that the viroLIE-gists’ so-called ‘gold standard’ amounts to nothing more than CPEs created after poisoning monkey kidney cell cultures — wink wink.
If a child can see through that pantomime, why can’t you?
Hey dipshit, thousands upon thousands have been disabled, lost everything, murdered by the jab and many children have become permanently disabled and this could happen again and all you care or think about is nudge, nudge wink, wink. You are a real ahole-wink wink nudge nudge.
Thanks for this IMPORTANT link! The language of this ‘A realistic pandemic scenario’ is so sickening, for example this: "activation of COBRA"..
You helped me to finally get older most homolog version of SPike protein which so far wass nearest to the peplomeric protein from 1987, patented by DUPHAR INTERNATIONAL RESEARCH B.V, which I can only recall was related to Wyeth, but not sure, since links are disappearing...
Now your info pointing to the polyprotein of the D68 virus, whose Philippine 2018 version (https://www.ncbi.nlm.nih.gov/protein/BCU83621.1) in comparison with SPike has 30% identities, shows that the integrin binding site "RGD" motif, essential in synthetic biology, was literally put there in one single long peptide (sorry for the format, not compatible with this editor:
And no matter how they alter the definition. Remember Fauci said in a congressional hearing that he did not participate in GOF but gave another name that was exactly the same thing. Then convinced them that the 2 were unrelated?
Lying to perpetuate the myth that GoF is more than a petrie dish of pure clones used for ALL virology experiments & has ZERO pandemic potential. These are grown in E.coli and other bacteria aka TRANSFECTION because they can NEVER replicate themselves but it is how ALL the mRNA shots were made... who benefits w this willful ignorance?
Five post-doc degree surfer Jessica knows this and thanked Dr Jay Couey for explaining RNA cannot pandemic in a livestream together with Jay, Robert Malone, Tess Laurie in 2023 but selling the fear of invisible enemy is riding a wave of fake heroes & comforts.
2016 NIH funded 1,200 page GoF Review.. it's a tool to test vaccines stuffing the GoF clones into rodents.. search "vaccine stockpile" or "however" that notes these models do not reflect reality or consider human immune system response.. Gain of Function is NOT magical power over Mother Nature but selling a lie of invisible enemy.
The only real problem with your argument that GoF is not dangerous is our recent experience. Weaponized anthrax mailed to US Officials in 2001 came from Fort Detrick. SARS-Cov-2 that caused the mess from 2019 to 2022 came from a lab in Wuhan. So, your comment sounds like a cheating spouse asking us to ignore our “lying eyes”. Thanks for your insights, but we are going to believe the evidence provided by our eyes.
Did the anthrax replicate or was the danger limited to the quantity of petrie dish contents in this equivalent to the mRNA TRANSFECTION contents? You are correct to equate the Covid jabs with the anthrax.. harm is not some chimera gone wild but what was made for direct contact... well done!
SARS-CoV-2 is an enveloped positive-strand RNA virus. It spreads on aerosol particles and causes a influenza like illness. SARS-CoV-2 was engineered in a lab as a result of Gain-of-Function research.
Anthrax is a disease caused by the anthrax bacteria. Infection typically occurs by contact with the skin, inhalation, or intestinal absorption. It is used as a bio-weapon.
The point is that these released into the population would not have happened if the facilities working with them as bio-weapons or for ‘bio-defense’ did not exist.
"SARS-CoV-2 is an enveloped positive-strand RNA virus. It spreads on aerosol particles and causes a influenza like illness. SARS-CoV-2 was engineered in a lab as a result of Gain-of-Function research. "
So models claim.. GoF is nothing but pure clones grown in bacteria.. you get high density high purity sequences but they do NOT have magical replication ability no matter how much GoF mythology spreads. There is NO mechanism for RNA to pandemic & nothing in nature is identical not even twins.. unchanged sequence is sole source Biotech Mafia clone it is NOT some conquest of natural biology. .
"SARS-Cov-2 that caused the mess from 2019 to 2022 came from a lab in Wuhan. So, your comment sounds like a cheating spouse asking us to ignore our “lying eyes”. "
Close to correct except the RNA sequence purported to leap from a petrie dish to blanket the planet is as ridiculous as Cat in the Hat pink snow. It is biologically impossible for RNA clones to do that and exactly WHY the GoF clones are grown in E.coli or other bacteria..
Replication is only possible with bacterial culture it c an't happen in air nor a bat's ass or cave it's a modeling lie that you are trusting.. it's a lab trick with worthless PCR as diagnostic but it continues to be great remnant stream for Human Genome Project tracking DNA from samples. Buying models as reality is where you need to focus the lying eyes mate!!
Agreed. Anyone still promoting the ‘virus’ Gain-of-Fiction PsyOp is propping up one of the most egregious hoaxes in human history — a hoax that keeps the fake germ-theory narrative and the allopathic crime scene flush with cash. The cost in death, disability, and deception is almost incalculable.
I strongly suggest anyone who’s fallen for this pantomime get reacquainted with the scientific method, and anyone promoting this fiction take a long, honest look in the mirror — because the reckoning for these deceptions is already underway, whether they recognise it or not.
And if that mirror starts to crack under the weight of their own lies, well… that’s just the truth finally refusing to reflect the serpent-tongued story they’ve been selling.
It is time citizens all over the world rise up in hordes 100 times worse than BLM and strike all these mfers down. No longer can we the people be passive. They want chaos, we will come for them and offer it on a silver platter. If we don't, we are giving up our lives and our childrens and grandchildrens lives.
These 'Frankenstein virus' experiments shouldn't just be globally banned; attempting to do these experiments should come with a mandatory death sentence. This is literally playing God and then f**king it up.
They've also been trying to mate Rabies with the airborne viruses. An airborne Rabies virus doesn't just wipe out all of humanity, it will take most of the mammal species on Earth with it.
Oh didn't you hear? It WAS banned. Many times in fact. At least that's what I thought. But you know, I get confused.
From Nuremburg to that fiasco in Japan where they spared all those murderers to get their bio weapon notebooks, pretty sure all this stuff was banned. Wasn't it?
Nuremburg for example. The original conference of sanctimony. BANNED all the bad stuff.
Because you know, they were righteously indignant.
Said really harsh and well deserved things about the bad people.
Then in 2020 to show just how serious and pissed off everyone was about the banned things Israel had no problem injecting "whatever the hell that was" into it's own population.
That'll show everyone that we mean business about bad things.
Seems like we've banned bio weapons and involuntary experiments over and over all my life. So much so that I was a little shocked when I heard they were doing bio weapons research all over the world.
You know, BECAUSE IT WAS BANNED. I mean sheez. We've learned it in school, from the Nuremburg trials to all sorts of national and international treaties. THIS STUFF IS BANNED! Isn't it? Guess I don't know what "banned" means. Just another fluid definition.
Seems I recall even Nixon banned bio weapons. Existential threat or something. Imagine that. The guy they made out to be the Great Satan, banned bioweapons. Even the designated Satan of our time said "bio weapons bad". Go figure.
Here's one of MANY liar links you can find with the Google that seems to say Nixon said "bio weapons bad". I'm sure he said it in a serious stern voice.
Then years later Nixon's polar opposite Obama seemed to say something that approximated bio weapons bad and stuff. I THOUGHT he banned Gain Of Function, at least domestically, but it was nearly impossible to find simple clear links. Almost as if his information is so highly curated by search engines it is hard to easily get a clear picture. Whatever. But, didn't he ban something that they got around by outsourcing it to Wuhan. WHATEVER. You never know because what they say (all of them) is almost meaningless.
So by golly, how the hell did I get confused thinking all these activities were banned?
No matter how many times you think something was banned, made unlawful, vilified, it never seems to go away. Right now the new thing to ban is mRNA. Fat chance. Wonder why that is?
Probably because you can't ban the criminal outlaw governments that do all the "banning".
When helping a friend who was bitten by a dog, the owner of the repeat offender didn’t allow the dog to be held in quarantine for a Rabies check, probably because of the cost, instead saying the dog had been run over and was buried. That is when I heard from Animal Control that if the dog did have Rabies, the virus would go airborne if the animal was dug up. Then how is it capsules of Rabies Virus have been dropped in desert or country environments, supposedly to innoculate the animals in that vicinity, with no thought for human infection from capsules or bites? Gates again, most likely. He needs a locked room with a handful of capsules and a rabid monkey.
How remarkably unpleasant this sounds. I had Giardia for 3 weeks in Nepal, while trekking around Annapurna, and got Amoebic dysentery after we got back to Kathmandu (all in 1988).
I was always good at diagnosing Giardia after that, though...
Maybe the aim is to force everyone to submit to injection with some alleged "vaccine" when the only alternative is to die wretchedly of this new virus.
The word "inhuman" should be removed from dictionaries. Nothing whatsoever is too vile for humans to do.
Viral GOF has been going on since the dawn of viruses. That is what genomic messengers (viruses) are designed to do. But Jessica is completely spot on when she said that GOF/virus chimeric people are trying to rationalize their insane experimentations by outpacing mother nature with respect to viral recombination events. And in doing so, are risking creating far more deadly viruses that might have never come into existence without their tinkering, with potentially devastating consequences
Yes, Lori, you are correct: "thousands upon thousands have been disabled, lost everything, murdered by the jab and many children have become permanently disabled and this could happen again.."
That all happened because people rolled up their sleeves for a toxic jab, believing it would shield them from a virus never proven to exist. Anyone who continues to promote the fraudulent germ-theory paradigm carries the blood of those lost souls on their hands. I’m not sure whether that includes you… I truly hope not.
And why are you hiding your comment? It’s so eloquently crafted.
I would agree with the purposes, but add in killing off people over about the age of 65, to save $ on Social Security, so they can more easily pay for the immigration invasion and so forth. The Agenda is a multi-level one and it all intertwines.
The evil cabal doesn't need to have any good reason to engineer anything and everything they can to harm and kill us, that's the point, they want us sick and or dead period, Do not live in fear, when you do, you feed the very ones harming humanity and everything in the the Cosmos. Do Not Comply, Do Not Fear!
Jessica, I honestly think you’ve lost the plot here. You keep reporting on ‘viruses’, nudge nudge, as if they’re a proven entity, when even a child can grasp that the virolie-gists’ so-called ‘gold standard’ amounts to nothing more than CPEs created after poisoning monkey kidney cell cultures — wink wink.
If a child can see through that pantomime, why can’t you?
Are you being paid to push fear, spin fiction into ‘science’, and churn out scary stories for fraudulent gain?
Ah, the old “infection clones” dodge — the last refuge of someone who can’t show a purified particle or a single experiment that actually follows the scientific method.
But let’s run with your claim for a moment: a clone of what, exactly? The cellular debris and chaos produced after poisoning monkey kidney cells? Which fragment of that toxic soup is supposedly being “cloned”?
And here’s the another kicker: what’s the mechanism of infection that a ‘clone’ of cellular debris is meant to undergo — and please identify which debris you think is being cloned?
Because if your answer is “lab-made constructs built from the aftermath of in vitro cell murder,” then you’ve just confirmed they’re not naturally occurring ‘viruses’ at all… which was precisely the point.
So thanks for validating the con: fabricated in vitro, rebranded in the media, and sold to the public as invisible boogeymen.
Now, care to provide actual evidence for these supposed clones — or is this yet another story we’re meant to take on faith?
Let's play fair in the sandbox here. You can disagree without being disagreeable. Might ought to drop the attempts to discredit, judge, shame, and censor.
Still crickets from JJ since I reached out to him. He’s probably thinking, ‘How on earth do I convince people that poisoning monkey kidney cells and watching them fall apart somehow proves the existence of a virus?’ More and more people are realising just how absurd that claim sounds.
Ah, the classic retreat: “I’m not a scientist, but here’s someone I heard on the internet — maybe you can try proving him wrong.”
Let’s be clear: if PhD JJ Couey is your authority, then you might want to listen to what he actually says. He believes in viruses. Full stop. He talks about viral replication, infection cycles, spike proteins, and “gain of fiction” — none of which exist if the only “evidence” is the ritual poisoning of cell cultures.
So you can’t hide behind Couey as your shield — but since you’re not a medical scientist, you can rely on basic logic: do you seriously believe that poisoning monkey kidney cells with a battery of chemicals, watching them break down, and then calling that breakdown “a virus” qualifies as proof of anything?
And if you’re asking me to “prove him wrong,” then you’ve already admitted you can’t defend your own claim. I’m asking you for the basics:
What is a virus?
Where is your purified, isolated particle — not created through poisoned cell cultures?
If you can’t answer those, quoting Couey won’t save you.
Btw, I’ve no issue reaching out to Couey in his fictional universe — what’s the best way to contact him so I can examine his claims directly?
I have long had a theory that many on this planet never reach the maturity or consciousness level beyond a 15-16-year-old-boy--because they simply can't. Just look at what they do, worldwide, with their bandwidth. The bat/pig explosive diarrhea virus gambit proves it once and for all.
As an aside, Yesterday was another example of their childishness. On Thanksgiving, the elites in France (Macrons in center stage) were out in full fancy with two demon/hybrids at a parade. They can no longer hide that they are juvenile delinquents.
Jessica - any awareness of GOF on enteroviruses? Asking because reportedly the UK did a table-top and more "exercise" for 3 months this fall for a pandemic targeting kids (pigs also mentioned) - their pathogen choice was the enterovirus EV-D68:
"The real EV-D68 is a respiratory virus first isolated in California in 1962, which has gained global traction. As well as respiratory disease and meningitis, it can cause a polio-like paralysis in children known as acute flaccid paralysis."
Interesting read as this "exercise" also included lockdowns, handling social distancing protests and more.
https://archive.ph/lOmhL
You talk of ‘viruses’, nudge nudge, as if they’re a proven entity, when even a child can grasp that the viroLIE-gists’ so-called ‘gold standard’ amounts to nothing more than CPEs created after poisoning monkey kidney cell cultures — wink wink.
If a child can see through that pantomime, why can’t you?
Hey dipshit, thousands upon thousands have been disabled, lost everything, murdered by the jab and many children have become permanently disabled and this could happen again and all you care or think about is nudge, nudge wink, wink. You are a real ahole-wink wink nudge nudge.
Thanks for this IMPORTANT link! The language of this ‘A realistic pandemic scenario’ is so sickening, for example this: "activation of COBRA"..
You helped me to finally get older most homolog version of SPike protein which so far wass nearest to the peplomeric protein from 1987, patented by DUPHAR INTERNATIONAL RESEARCH B.V, which I can only recall was related to Wyeth, but not sure, since links are disappearing...
Now your info pointing to the polyprotein of the D68 virus, whose Philippine 2018 version (https://www.ncbi.nlm.nih.gov/protein/BCU83621.1) in comparison with SPike has 30% identities, shows that the integrin binding site "RGD" motif, essential in synthetic biology, was literally put there in one single long peptide (sorry for the format, not compatible with this editor:
Query 385 TKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLP--DDFTGCVIAWNSN-439
_____________TK+__D C________D+ +_____E+ + +_______K D +LP_____DD+____V++ +++
Sbjct 1603 TKVLDACALRDLTDTNL----EITIVKLDRNQKFRDIRHFLPRYEDDYNDAVLSVHTSKF 1658
Query 440 -NLDSKVGGNYNY 451
_______________N+___VG_____NY
Sbjct 1659 PNMYIPVGQVTNY 1671
The important fragment between both is that:
Query 797 FGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQY 837
_____________F G +L + P ++ E+ +F+K T ++ +Y
Sbjct 1762 FEGSKEPAVL-NSKDPRLKTDFEEAIFSKYTGNKIMLMDEY 1801
'KRSFIEDLLFNKVT' section from https://www.ncbi.nlm.nih.gov/protein/7SKZA
The original 1962 in comparison with the 2018 share 95% identity.
Death penalty for anyone funding or doing this GOF research. Start with Bill and Faucho.
And no matter how they alter the definition. Remember Fauci said in a congressional hearing that he did not participate in GOF but gave another name that was exactly the same thing. Then convinced them that the 2 were unrelated?
Participating in GOF research should be a capital offense.
Lying to perpetuate the myth that GoF is more than a petrie dish of pure clones used for ALL virology experiments & has ZERO pandemic potential. These are grown in E.coli and other bacteria aka TRANSFECTION because they can NEVER replicate themselves but it is how ALL the mRNA shots were made... who benefits w this willful ignorance?
Five post-doc degree surfer Jessica knows this and thanked Dr Jay Couey for explaining RNA cannot pandemic in a livestream together with Jay, Robert Malone, Tess Laurie in 2023 but selling the fear of invisible enemy is riding a wave of fake heroes & comforts.
2016 NIH funded 1,200 page GoF Review.. it's a tool to test vaccines stuffing the GoF clones into rodents.. search "vaccine stockpile" or "however" that notes these models do not reflect reality or consider human immune system response.. Gain of Function is NOT magical power over Mother Nature but selling a lie of invisible enemy.
https://web.archive.org/web/20161206155142/http://www.gryphonscientific.com/wp-content/uploads/2016/04/Risk-and-Benefit-Analysis-of-Gain-of-Function-Research-Final-Report.pdf
Yes, big shout out to JJ Couey.
Get your fricking safe and highly effective leaking shedding bioweapon boosters now!
👏👏 you bullseyed that target!
The only real problem with your argument that GoF is not dangerous is our recent experience. Weaponized anthrax mailed to US Officials in 2001 came from Fort Detrick. SARS-Cov-2 that caused the mess from 2019 to 2022 came from a lab in Wuhan. So, your comment sounds like a cheating spouse asking us to ignore our “lying eyes”. Thanks for your insights, but we are going to believe the evidence provided by our eyes.
Did the anthrax replicate or was the danger limited to the quantity of petrie dish contents in this equivalent to the mRNA TRANSFECTION contents? You are correct to equate the Covid jabs with the anthrax.. harm is not some chimera gone wild but what was made for direct contact... well done!
SARS-CoV-2 is an enveloped positive-strand RNA virus. It spreads on aerosol particles and causes a influenza like illness. SARS-CoV-2 was engineered in a lab as a result of Gain-of-Function research.
Anthrax is a disease caused by the anthrax bacteria. Infection typically occurs by contact with the skin, inhalation, or intestinal absorption. It is used as a bio-weapon.
The point is that these released into the population would not have happened if the facilities working with them as bio-weapons or for ‘bio-defense’ did not exist.
"SARS-CoV-2 is an enveloped positive-strand RNA virus. It spreads on aerosol particles and causes a influenza like illness. SARS-CoV-2 was engineered in a lab as a result of Gain-of-Function research. "
So models claim.. GoF is nothing but pure clones grown in bacteria.. you get high density high purity sequences but they do NOT have magical replication ability no matter how much GoF mythology spreads. There is NO mechanism for RNA to pandemic & nothing in nature is identical not even twins.. unchanged sequence is sole source Biotech Mafia clone it is NOT some conquest of natural biology. .
"SARS-Cov-2 that caused the mess from 2019 to 2022 came from a lab in Wuhan. So, your comment sounds like a cheating spouse asking us to ignore our “lying eyes”. "
Close to correct except the RNA sequence purported to leap from a petrie dish to blanket the planet is as ridiculous as Cat in the Hat pink snow. It is biologically impossible for RNA clones to do that and exactly WHY the GoF clones are grown in E.coli or other bacteria..
Replication is only possible with bacterial culture it c an't happen in air nor a bat's ass or cave it's a modeling lie that you are trusting.. it's a lab trick with worthless PCR as diagnostic but it continues to be great remnant stream for Human Genome Project tracking DNA from samples. Buying models as reality is where you need to focus the lying eyes mate!!
Agreed. Anyone still promoting the ‘virus’ Gain-of-Fiction PsyOp is propping up one of the most egregious hoaxes in human history — a hoax that keeps the fake germ-theory narrative and the allopathic crime scene flush with cash. The cost in death, disability, and deception is almost incalculable.
I strongly suggest anyone who’s fallen for this pantomime get reacquainted with the scientific method, and anyone promoting this fiction take a long, honest look in the mirror — because the reckoning for these deceptions is already underway, whether they recognise it or not.
And if that mirror starts to crack under the weight of their own lies, well… that’s just the truth finally refusing to reflect the serpent-tongued story they’ve been selling.
It is time citizens all over the world rise up in hordes 100 times worse than BLM and strike all these mfers down. No longer can we the people be passive. They want chaos, we will come for them and offer it on a silver platter. If we don't, we are giving up our lives and our childrens and grandchildrens lives.
These 'Frankenstein virus' experiments shouldn't just be globally banned; attempting to do these experiments should come with a mandatory death sentence. This is literally playing God and then f**king it up.
They've also been trying to mate Rabies with the airborne viruses. An airborne Rabies virus doesn't just wipe out all of humanity, it will take most of the mammal species on Earth with it.
Oh didn't you hear? It WAS banned. Many times in fact. At least that's what I thought. But you know, I get confused.
From Nuremburg to that fiasco in Japan where they spared all those murderers to get their bio weapon notebooks, pretty sure all this stuff was banned. Wasn't it?
Nuremburg for example. The original conference of sanctimony. BANNED all the bad stuff.
Because you know, they were righteously indignant.
Said really harsh and well deserved things about the bad people.
Then in 2020 to show just how serious and pissed off everyone was about the banned things Israel had no problem injecting "whatever the hell that was" into it's own population.
That'll show everyone that we mean business about bad things.
Seems like we've banned bio weapons and involuntary experiments over and over all my life. So much so that I was a little shocked when I heard they were doing bio weapons research all over the world.
You know, BECAUSE IT WAS BANNED. I mean sheez. We've learned it in school, from the Nuremburg trials to all sorts of national and international treaties. THIS STUFF IS BANNED! Isn't it? Guess I don't know what "banned" means. Just another fluid definition.
Seems I recall even Nixon banned bio weapons. Existential threat or something. Imagine that. The guy they made out to be the Great Satan, banned bioweapons. Even the designated Satan of our time said "bio weapons bad". Go figure.
Here's one of MANY liar links you can find with the Google that seems to say Nixon said "bio weapons bad". I'm sure he said it in a serious stern voice.
https://en.wikipedia.org/wiki/Statement_on_Chemical_and_Biological_Defense_Policies_and_Programs
Then years later Nixon's polar opposite Obama seemed to say something that approximated bio weapons bad and stuff. I THOUGHT he banned Gain Of Function, at least domestically, but it was nearly impossible to find simple clear links. Almost as if his information is so highly curated by search engines it is hard to easily get a clear picture. Whatever. But, didn't he ban something that they got around by outsourcing it to Wuhan. WHATEVER. You never know because what they say (all of them) is almost meaningless.
So by golly, how the hell did I get confused thinking all these activities were banned?
No matter how many times you think something was banned, made unlawful, vilified, it never seems to go away. Right now the new thing to ban is mRNA. Fat chance. Wonder why that is?
Probably because you can't ban the criminal outlaw governments that do all the "banning".
When helping a friend who was bitten by a dog, the owner of the repeat offender didn’t allow the dog to be held in quarantine for a Rabies check, probably because of the cost, instead saying the dog had been run over and was buried. That is when I heard from Animal Control that if the dog did have Rabies, the virus would go airborne if the animal was dug up. Then how is it capsules of Rabies Virus have been dropped in desert or country environments, supposedly to innoculate the animals in that vicinity, with no thought for human infection from capsules or bites? Gates again, most likely. He needs a locked room with a handful of capsules and a rabid monkey.
How remarkably unpleasant this sounds. I had Giardia for 3 weeks in Nepal, while trekking around Annapurna, and got Amoebic dysentery after we got back to Kathmandu (all in 1988).
I was always good at diagnosing Giardia after that, though...
;-)
i got giardia from tap water in Alberta. i had the screaming shits for 6 months straight.
Docs in US and apparently Canada, seem to be blind to Giardia.
They think people are delusional first. ;-(
You've heard of Dirty Money...The end justifies the means...Now meet Dirty Science...Pigs Might Fly
I think this is the "jumping the shark" moment... anyone else else here agree?
Are we winning yet?
Maybe the aim is to force everyone to submit to injection with some alleged "vaccine" when the only alternative is to die wretchedly of this new virus.
The word "inhuman" should be removed from dictionaries. Nothing whatsoever is too vile for humans to do.
Virus of fear mongering seems to be working, based on comments here. Other than that, GOF is fantasy.
Viral GOF has been going on since the dawn of viruses. That is what genomic messengers (viruses) are designed to do. But Jessica is completely spot on when she said that GOF/virus chimeric people are trying to rationalize their insane experimentations by outpacing mother nature with respect to viral recombination events. And in doing so, are risking creating far more deadly viruses that might have never come into existence without their tinkering, with potentially devastating consequences
Quite so Rose. As I have said to others, pig manure is toxic enough already anyway.
https://baldmichael.substack.com/p/gain-of-function-and-anthony-fauci?utm_source=publication-search
Big question. How do we protect against this?
NASA-rated full body suit.
Evil knows no bounds. If something can be done it will be done with no moral or ethical disturbance on the part of those doing it.
Yes, Lori, you are correct: "thousands upon thousands have been disabled, lost everything, murdered by the jab and many children have become permanently disabled and this could happen again.."
That all happened because people rolled up their sleeves for a toxic jab, believing it would shield them from a virus never proven to exist. Anyone who continues to promote the fraudulent germ-theory paradigm carries the blood of those lost souls on their hands. I’m not sure whether that includes you… I truly hope not.
And why are you hiding your comment? It’s so eloquently crafted.
I would agree with the purposes, but add in killing off people over about the age of 65, to save $ on Social Security, so they can more easily pay for the immigration invasion and so forth. The Agenda is a multi-level one and it all intertwines.
https://ia801507.us.archive.org/1/items/new_order_of_barbarians/new_order_of_barbarians.pdf
The evil cabal doesn't need to have any good reason to engineer anything and everything they can to harm and kill us, that's the point, they want us sick and or dead period, Do not live in fear, when you do, you feed the very ones harming humanity and everything in the the Cosmos. Do Not Comply, Do Not Fear!
Jessica, I honestly think you’ve lost the plot here. You keep reporting on ‘viruses’, nudge nudge, as if they’re a proven entity, when even a child can grasp that the virolie-gists’ so-called ‘gold standard’ amounts to nothing more than CPEs created after poisoning monkey kidney cell cultures — wink wink.
If a child can see through that pantomime, why can’t you?
Are you being paid to push fear, spin fiction into ‘science’, and churn out scary stories for fraudulent gain?
It’s probably infections clones (lab made) that they call viruses.
Ah, the old “infection clones” dodge — the last refuge of someone who can’t show a purified particle or a single experiment that actually follows the scientific method.
But let’s run with your claim for a moment: a clone of what, exactly? The cellular debris and chaos produced after poisoning monkey kidney cells? Which fragment of that toxic soup is supposedly being “cloned”?
And here’s the another kicker: what’s the mechanism of infection that a ‘clone’ of cellular debris is meant to undergo — and please identify which debris you think is being cloned?
Because if your answer is “lab-made constructs built from the aftermath of in vitro cell murder,” then you’ve just confirmed they’re not naturally occurring ‘viruses’ at all… which was precisely the point.
So thanks for validating the con: fabricated in vitro, rebranded in the media, and sold to the public as invisible boogeymen.
Now, care to provide actual evidence for these supposed clones — or is this yet another story we’re meant to take on faith?
Let's play fair in the sandbox here. You can disagree without being disagreeable. Might ought to drop the attempts to discredit, judge, shame, and censor.
Thank you Elizabeth. I am increasingly convinced that I got myself into convo with a bot. But now, I am done. No point.
I am not a medical scientist. It’s PhD J. J. Couey, who speaks about it extensively and there are no takers to prove him wrong. Maybe you could try?
Still crickets from JJ since I reached out to him. He’s probably thinking, ‘How on earth do I convince people that poisoning monkey kidney cells and watching them fall apart somehow proves the existence of a virus?’ More and more people are realising just how absurd that claim sounds.
https://substack.com/profile/69610057-factscinator/note/c-182518375?utm_source=notes-share-action&r=15fzgp
Ah, the classic retreat: “I’m not a scientist, but here’s someone I heard on the internet — maybe you can try proving him wrong.”
Let’s be clear: if PhD JJ Couey is your authority, then you might want to listen to what he actually says. He believes in viruses. Full stop. He talks about viral replication, infection cycles, spike proteins, and “gain of fiction” — none of which exist if the only “evidence” is the ritual poisoning of cell cultures.
So you can’t hide behind Couey as your shield — but since you’re not a medical scientist, you can rely on basic logic: do you seriously believe that poisoning monkey kidney cells with a battery of chemicals, watching them break down, and then calling that breakdown “a virus” qualifies as proof of anything?
And if you’re asking me to “prove him wrong,” then you’ve already admitted you can’t defend your own claim. I’m asking you for the basics:
What is a virus?
Where is your purified, isolated particle — not created through poisoned cell cultures?
If you can’t answer those, quoting Couey won’t save you.
Btw, I’ve no issue reaching out to Couey in his fictional universe — what’s the best way to contact him so I can examine his claims directly?
gigaohm biological is Couey's website.
Cheers, for info!!
https://substack.com/profile/69610057-factscinator/note/c-182518375?utm_source=notes-share-action&r=15fzgp
Cheers! Just joined JJ “Cootie” Couey’s Substack. I’m bracing myself to engage with a tsunami of life-altering wisdom—one pearl at a time.
Virology is a crap idea in my books. Jessica's article is very sadly a big joke.
Anyway if one needs healing from pig diseases, one should go the whole hog and use a remdial oinkment.
When will this pantomime stop and the people go home?